Wednesday, November 20, 2019

Plato's educational plan Essay Example | Topics and Well Written Essays - 500 words

Plato's educational plan - Essay Example Specifically, this paper will discuss some of the aspects of educational theory presented by Plato, and will endeavor to analyze it with respect to contemporary public education system in the United States. It is essential to discuss the educational plan presented by Plato, in order to acquire a comparison with the contemporary education system. According to Plato’s philosophical discourse, philosopher kings have the highest authority in the society. In other words, Plato proposed functional state where everyone is given a different responsibility according to his capabilities. Moreover, educational plan of Plato has divided the society in three classes, producers, guardians, and lastly, the Philosopher King. In Plato’s society, primary education on general level is provided to individuals until the age of eighteen, which is followed by severe physical education for a period of two years. (Griffith, 2000) Upon completion, individuals performing ill in their studies are listed in the category of producers that involves merchants, artisans, and laborers. On the other hand, painstaking mathematical education is received by individuals performing well during attainment of pri mary education, as mathematics was considered the most essential study required for understanding of ‘forms’. Conclusion of this phase of education results in another assessment of individuals, where unsuccessful candidates are propelled into the category of Guardians. In Plato’s society, Guardians play a more significant role, as compared with producers’ category. Guardians involve warriors, administrators, policy makers, and auxiliaries. Successful individuals move on with studying dialectic for a period of five years. Lastly, most successful members of the society participate in managing city as an apprentice for a final period of fifteen years. Plato’s society is a meritocratic society, where best of the best receives the

Monday, November 18, 2019

How does amount of CO2 vary in the places with a high amount of cars Lab Report

How does amount of CO2 vary in the places with a high amount of cars comparing to the fields - Lab Report Example The components of the fields determine the level of consumption that the field uses of the component while the cars release it. Cars release a substantial amount of the carbon dioxide the world environment suffers from (Mintzer. p.202). The study is developed to detail these studies and aid in understanding their effects on the environment. How does the amount of carbon dioxide vary in the places with a high amount of cars comparing to the fields? This question provides a more general approach to the study. A more direct question would include a coverage that includes the activities in an environment and the effect that they have on the volume of carbon dioxide. The question would consider the effect that the presence of cars in an environment would have creating a difference between the amounts of carbon dioxide in the two places. That is the fields and places with many cars. Based on these, the research question therefore would be: What effects does the level of activity in the environment have on the amount of carbon dioxide in relation to the presence of cars and their absence in a field? Places with cars have high carbon dioxide volumes while fields have low carbon dioxide volumes. Considering the volumes that cars emit in carbon dioxide, one discovers that chances prove high that places with many cars have a high carbon dioxide content compared to fields. The study aims at proving this hypothesis. The variables include two aspects that are the amount of carbon dioxide and the place or environment that is between a place with a high amount of cars and fields, which have a small amount of cars. In the study, the level of carbon dioxide provides the dependent variable whose volume depends on the environment and the activity in it in relation to cars. This means the environment is the independent variable. To understand further the effect that

Friday, November 15, 2019

Securities And Investment Fraud Criminology Essay

Securities And Investment Fraud Criminology Essay It has been a long time since financial crime has been identified and the body of research in this type of issue has been growing rapidly. Today this research provide covers a wide range of topic ranging from financial studies to social implication of the study as well as to research to prevention and best practices that may help to stop this fast growing issue. This chapter will provide an overview of the impact of financial crime, the steps used to address this problem and briefly assess the theories of about financial crime in the world. Definition and types of financial crimes There is no broad concensus on the meaning of financial crime but it can be understood that it is any type of illegal activity that result in an economic loss.Financial crimes, sometimes defined to as white collar crimes, are nonviolent criminal acts comitted to gaine illegal monetary. According to the United Nation Office on Drug and Crime (UNODC) financial crime can be viewed as any non-violent crime that results in a financial loss which includes computer crime and dishonest practices. Financial crimes is a critical issue and it has likely devastating economic, security and social impact. It encourages drug dealers, terrorists, illegal arm dealer, corrupt public officials and others to operate and expand their criminal enterprises.According to Petter Gottschalk, (2010), financial crime can be categoried in corruption, fraud, theft and manipulation . There are different types of financial crime. These types are as follows: Money Laundering According to Jeffrey Simser, (2006), money laundering can be defined as a technique designed to make illicit acquisitive gains appear legitimate, usually by disguising the propertys illegal provenance. In other words, perpetrators are trying to cover-up the monetary sources obtained from illegal transactions so that it look like it was acquired from legal sources. Commonly, according to (Schneider, 2004; Cassella, 2004), money laundering has been described as a cycle taking place in three different stages. Firstly, Placement, the stage at which illegal funds are introduced in the financial system mainly deposited in a bank account.Layering, the stage of the process in which the property is moved around from bank to bank and its ownership and source is covered-up in order to keep it away from its illicit source and the final stage at which the property is re-introduced into the legitimate economy. Embezzlement According to williams (2006), embezzlement can be defined as the dishonest appropriation to personal use or benefit of property or money entrusted by another. The actor first comes into possession of the property with the permission of the owner. Embezzlement can often occur between trusted friends or even relatives, but also occurs in simple businesses as well. Conscientious examination of financial records by the fund owner can help reveal signs of embezzlement, such as missing funds, duplicated checks, or accounting errors. Credit card fraud Pickett and Pickett (2002) suggested that credit card fraud is the use of stolen credit card details to get access to the goods or services in the name of the cardholder. Sometimes a brand new credit card is falsified using known details. Cards can be stolen or details obtained from files that are not properly safe. Securities and investment fraud Securities fraud is a type of financial crime that is involved in illegal manipulation of values of financial market. It includes insider trading, preferential rates, and misrepresentation of value. The types of misrepresentation implicated in this crime include providing false information and giving bad advice. Insider trading occurs when a person reveals information about an investment then uses the information to buy or sell shares with a business. Preferential rates and misrepresentation both implicate inflating or deflating the value of stocks in order to manipulate the market. Investment Property is the Property sold as a certified investment with high returns. The victim is influenced to buy investment property with a property management firm that will deal all the loan documents. The victim reassured and told that he or she has to do nothing other than be the buyer and borrower. Then the victim finds that the property was increased in value,no loan payments have ever been done, and any collected rents have been stolen as well. Identity theft and Phising Laundon and Laudon (2010) defines identity theft as a crime in which a pretender gets personal information, such as social security identification numbers, drivers license numbers, or credit card, name, address, drivers license, date of birth, Social Security number, account information, account login credentials, or family identifiers to pretend to be someone else. According to Higgins et al., (2008), iIdentity theft is the illegal use of anothers personal identifying information.It implicate financial or other personal information stolen with the intention of to be someone else. Phishing is defined as the technology or social engineering used to attract victims to reveal their personal information such as account numbers, login IDs, passwords, and other confirmable information that can then be exploited for illicit purposes, including identity theft. Phishing is most often commited through mass emails and spoofed websites. Counterfeiting Counterfeiting is a pernicious crime as it corrupts the monetary system. Counterfeiting implaicates the use of fake money, such as manufacturing falsely bills and coins with a more valuable version. Therefore, counterfeiting can break up the flow of inflation and deflation by adding more falsely money into a controlled system and also threaten global security, as these activities are sometimes committed by terrorists and other dangerous criminals to finance their activities or disguise their profits (Interpol, 2009). Mail Fraud Internet sales or online auction fraud The perpetrator agrees to buy an item available for sale on the Internet or in an online auction. The seller is told that he or she will be sent an official check (e.g., cashiers check) via overnight mail. When the check arrives, it is several hundred or thousand dollars more than the agreed-upon selling price. The seller is instructed to deposit the check and refund the overpayment. The official check is subsequently returned as a counterfeit but the refund has already been sent. The seller is left with a loss, potentially of both the merchandise and the refund. Bank Fraud This is criminal acts committed in connection with bankruptcy or liquidation proceedings. A person filing for bankruptcy or a business that has gone into liquidation can hide assets after proceedings have been initiated, thereby preventing creditors from collecting their claims. However, most of the criminal acts are typically committed before bankruptcy/liquidation proceedings are initiated, e.g. the debtor has failed to keep accounts or has unlawfully withdrawn money from the business (Økokrim, 2008). Bribery and corruption THEORIES ON FINANCIAL CRIME : WHAT ARE THE FACTORS INFLUENCING FINANCIAL CRIME? A theory is a forecasting or justification of a fact. According to Petter Gottschalk, (2010), the body of research of financial crime is divided into three branches: Behavioral theories According to Hansen (2009), distinction can be made between economic, business, and elite crimes. Participants employed in reputed financial institutions commit most of such crimes. Employees for their own benefits instead of for the business benefits, commit occupational or greatest crime. Hansen (2009) suggested that people commit crime because of low self-control. Duffield and Grabsky (2001) describe some of the key motivational and psychological factors that lead to financial crime. They stated that fraud can be explained by three factors: 1) An increased in motivated criminals, 2) The availability of suitable funds, and 3) The absence of security. As Nettler noticed the intensity of desire and the perception of opportunity are personality variables. The balance between desire and opportunity moves. Temptation to steal fluctuates with individual temperament and situation (Nettler 1974, p.75).Motivation is, therefore, a combination of an individuals personality and the opportunity which they get. Fraud is mainly committed by motivated and determined organized participants for the only reason; financial benefits Greed Fraud is executed by motivated groups of organised actors determined only for financial profit. According to the Drugs and Crime Prevention Committee of Victoria,an increase in recent years of organised criminals in illicit and suspicious activity implicate mostly external attacks on banks, superannuation funds and business. Duffield Grabosky (2001) noted that greed lies at the heart of much dishonest activity in the society. Emerging Trends in ones lifestyle People are convince to have recourse to financial crime due to the changes in financial condition that exceed their control. Unfortunately some are capitulated to commit illicit act to maintain a good standard of living. Financial Strain Financial strain caused by gambling problem is an area of concern (Duffield Grabosky 2001). The cost of suspicious drugs contributes also to financial stress on individuals who take part in them therefore they are tempted to commit crime in order to get money. According to the Drug and Crime Prevention of Victoria, relationship or marital breakdowns causes, both financial and emotional stress which can represent a sudden decrease in the standard of living of an indvidual together with a feeling of powerlessness and resentment, ones can have recourse to financial crime in order to earn a good living. Power Duffield and Grabosky (2001) noted the desire some people have for power over others and over situations. In other words, the feeling of power over individual appears to be a determined force to perform illicit act by taking advantage on weak people. Misunderstandings Poor communication can arise some form of dishonesty. According to Neville (2000), complaints have been made each year in Victoria against sollicitors for misappropriation of assets or income that concern poor communication between practitioners and their clients. Practitioners may be found guilty for not following the standard of conduct. Organizational theories A financial crime often takes place in form of an organized crime. According to Petter Gottschalk (2010), criminal organization acts as a monopolistic firm, and the theory of monopoly is used to estimate organized crimes. In organized crime, Shvarts (2001) suggests that rational choice theory can explain the rise of the Russian Mafia that is because of low income and financial difficulties allied with an exploiting police force, they had any choice to have recourse to crime to afford their standard of living. Rational choice theory states that people commit crimes after acknowledging the punishment for the crimes, as well as the rewards of completing these acts successfully. Examples of this theory include the bank teller who is experiencing personal financial difficulty and decides to loot funds from the bank in order to increase his standard of living (Lyman and Potter, 2007). Gross (1978) argued in his classical article on the theory of organizational crime that studies of crime, and delinquency have a strong theoretical base. He gave two important theoretical relationships. Firstly, the internal structure and setting of organizations is that in order for the goals to be acheived , the organization will be forced to violate the rules and regulation set in the business. Secondly, the perpetrators will associate with the upward mobility of the organization and likely willing and able to commit crime for the business to attain its goals and to prosper.Bruinsma and Bernasco (2004) used social network theory to explain the differences in social organization between criminal groups that is criminal organization have a network structure which is related to the legal and financial risks associated with the crimes Managerial theories According to Eisenhardt (1985), agency theory is involved with agreeing two problems that can occur in agency relationships. Firstly, the agency problem arises when the desires or goals of the principal and agent disaccord and it is fuzzy and costly for the principal to verify what the agent is doing. Secondly, is the problem of risk sharing that take place when the principal and agent have different risk preferences, goals and do not share profits which occur due to accessibility of new technology. Garoupa (2007) adapted agency theory to criminal organizations. He categorized the criminal firm as a family business with one principal and several agents. Alliance theory is concerned with partnership,often happens in criminal organizations, it reduce the risk of incompetent legal provision. Trust is an important factor in partnerships. Criminal organizations are often based on trust between its members. Governmental Theories Adverse government structures can also be a motivating factor to financial crime. An increased in economic activities together with a weak system in a country including weak government capacity and weak democracy, poor remuneration of public servants, lack of transparency in government institutions and weak rule of law has increased the opportunities for people to have recourse to economic and financial crime .

Wednesday, November 13, 2019

Poverty and Nutrition in America Essay -- Low-Income and Food Insecure

For most Americans, the word poverty means insufficient access to to housing, clothing and nutritious food that meet their needs for a healthy life. A consequence of poverty is a low socioeconomic status that leads to being exposed to poor nutrition. Since food and dietary choices are influenced by income, poverty and nutrition go hand in hand. There are many important factors that threaten the nutritional status of poor people. The number one factor is not having enough money to buy food of good quality and quantity. Not having enough money can have a profound impact on the diets of low-income people. Limited financial resources may force low income people to make difficult decisions about what kind and how much food to buy. Limited financial resources often lead to food insecurity. According to Gundersen, Waxman, Engelhard, and Brown (2011) food insecurity is the lack of access to healthy food in quantity or quality. Poverty is regarded as the major cause of food insecurity. A household food security depends on access to food. America has access to good healthy food. However, a family too poor to buy them do not enjoy food security. Rosenbaum and Neuberger (2005) report that each year the number of people using government food assistance programs grows. â€Å"Food stamps are targeted to those with the greatest need for help in purchasing food†¦ [and] helps to lessen the extent and severity of poverty (Rosenbaum and Neuberger 2005)†. Gundersen, Waxman, Engelhard, and Brown (2010) found in their study that 50 million people (including 17 million children) were food insecure in 2010. Poverty and food insecurity affects the lives of billions of people worldwide and millions of people in the United States. More than two billion pe... ...ysical activity. Child Trends 2 (3): 1-9. Retrieved from http://www.childtrends.org/Files/Child_Trends_2011_07_25_ECH_HealthyEating.pdf Powell, L.M., Slater, S., Mirtcheva, D., Bao, Y., & Chaloupka, F.J. (2007). Food store availability and neighborhood characteristics in the United States. Preventive Medicine, 44, 189-195. Rosenbaum, D. & Neuberger, Z. (2005, August 17). Food and nutrition programs: Reducing hunger and bolstering nutrition. Retrieved from http://www.cbpp.org/cms/?fa=view&id=510 United Nations Children’s Fund. (2012). Nutrition - What is the role of nutrition? Retrieved from http://www.unicef.org/nutrition/index_role.html United State Department of Agriculture and U.S. Department of Health and Human Services (2010, December). Dietary Guidelines for Americans, 2010, 7th Edition, Retrieved from http://www.cnpp.usda.gov/Publications/DietaryGuideli

Sunday, November 10, 2019

Talisman Energy

Talisman Energy Inc. (Talisman) is an independent Canadian oil and gas producer. Talisman is a company that has been through a great deal of criticism due to their negative experience in Sudan in previous years. They were accused of numerous things such as fueling the civil war, believing the Sudanese Government was using oil revenues to purchase weaponry, and of being complicit in human rights abuses because of fees and royalties paid to the government for the rights to explore oil and gas.Now, Talisman is faced with the decision of whether or not they should enter into Kurdistan, knowing that the same thing can happen there as it did in Sudan. The KRG is asking for $220 million in exchange for allowing Talisman to search for oil reserves. Not knowing what the KRG will use the money for, whether it’s to improve economic development or to purchase weaponry creates a dilemma for Talisman. The board of directors had first-hand experience of the damage to Talisman’s reputa tion. With proper due diligence and continuous re-evaluation of the situation in Kurdistan, Talisman should now find it easier to discover political risk and solve problems before they arise.Problem StatementTalisman Energy Inc. has encountered problems in the past when entering into politically unstable markets in other countries. Now they are faced with the decision whether to enter the oil-rich Kurdistan region of Iraq, knowing there are great risks associated with it. If they decide to enter Kurdistan, can they do it without facing the same problems as they did in Sudan?AnalysisTalisman’s interest in pursuing oil exploration in the Kurdistan region of Iraq has been shaped by many factors. First being that Kurdistan is estimated to have 39 million barrels of oil reserves. Second, Talisman was optimistic about the opportunity for foreign oil companies to tap into Iraqi oil now that Saddam Hussein had been defeated. Finally, the Kurdistan area was viewed as significantly saf er than the rest of Iraq. Talisman Energy Inc. is a company who has experience doing business in countries with high political risk. Political risk can be caused by conflict and violence, terrorism and kidnapping, property seizure, policy changes, and local  content requirements (Wild & Wild, International Business, 2012). Corruption sometimes plays a role in international business. See table 1 for the Corruption perception index. The higher the CPI score the less corruptive the country is.Table 1 Corruption Perception Index CountryCPI ScoreFinland9.0 to 10.0 Canada8.0 to 8.9 United States of America7.0 to 7.9 Spain6.0 to 6.9 Hungary5.0 to 5.9 Greece4.0 to 4.9 Mexico3.0 to 3.9 Russia2.0 to 2.9 Iraq1.0 to 1.9Talisman is now faced with the decision of whether or not they should enter into Kurdistan given the uncertainty in such an unstable region. Have they done the proper due diligence to proceed into Iraq. Iraq is a region with high political risk see Exhibit 1 (Wild & Wild, Inter national Business, 2012).Exhibit 1 Political risk around the WorldIn retrospect, should Talisman have gone into Sudan?Talisman made a good decision by entering Sudan. They were aware of the risks but the rewards were potentially high. It was for this reason they took the chance. They were faced with many challenges such as being blamed for influencing the Civil War. Overcoming these challenges only made the company stronger and more knowledgeable for similar future situations. What are the learnings from the Sudan experience?Talisman learned a great deal from the Sudan experience. They established a dedicated Corporate Responsibility Group (CR) in response to the events in Sudan. The CR group have developed Talisman’s CR policies, procedures and  reporting protocols. Over the years, they have included government relations and responsibility for assessing the risks involved in new projects, especially when entering countries that have high political risk. The company has als o added the International Code of Ethics for Canadian Business to its existing corporate code of ethics (Talisman Energy Inc.: The Decision to Enter Iraq, 2009). For more information on how Talisman manages their corporate responsibility see Exhibit 2.Exhibit 2 Talisman managing Corporate Responsibility Their commitment to corporate responsibility is founded in their company values. Their people put these values into action daily. Their dedication to making Talisman a great corporate citizen is built into the policies, systems, procedures and practices they have put in place to keep them improving. Their values include: Safety: Their goal is to create working conditions that cause no harm to people. Passion: They inspire others by the passion they demonstrate in their work. Results: They have a bias for results and take initiative to get things done efficiently, creating value for their shareholders. Respect: They take time to consider and appreciate other people’s points of view and treat the environment with respect.Excellence: They strive for excellence in what they do and how they do it. Teamwork: by working effectively together, they can deliver results far beyond their individual capabilities. Honest communication: They show courage to speak honestly and support others to do the same. How much money can Talisman make by entering Iraq?If the U.S geological survey is correct in estimating Kurdistan to have 39 billion barrels of oil reserves, then Talisman can make an enormous amount of money by entering Kurdistan. The world demand for oil in 2008 is forecast at 87 million barrels per day and the price of oil was US$130 per barrel (Talisman Energy Inc.: The Decision to Enter Iraq, 2009). The profit would be in the trillions. These large figures could cloud ones judgement when making such an important decision as this. The resources are there to generate huge profits but the circumstances they have to go through to do so  will have to be examined. W hat are the costs and benefits for Talisman to enter Iraq?CostsA 220 million dollar payment has to be paid to the Kurdistan Regional Government. Talisman’s entry might be viewed as support for the Kurdistan government as it was in Sudan and as a result there could be opposition form the U.S government, which supports the unity of Iraq and the Iraqi central government. There has yet to be an agreement on revenue sharing (Talisman Energy Inc.: The Decision to Enter Iraq, 2009). This could cause problems between the central government and the Kurdistan Regional government. A decision to enter Iraq could ruin the reputation of the company if the same thing were to happen there as in Sudan. The Iraqi central government controls Iraq’s export pipeline system. Without the ability to export the oil, Talismans oil revenue would be significantly curtailed.Benefits†¢Have access to large amounts of oil reserves. †¢Financial growth resulting in trillions of dollars in pro fit. †¢An opportunity to invest in the region of Kurdistan. †¢An opportunity to increase the company’s overall market share. †¢An increased level of profit as a result of cheaper labour than other business ventures.Discussion of AlternativesThere are some alternatives that may help solve Talisman’s problems. Presented here are some advantages and disadvantages of each as well as how each would affect the company as a whole and the country in which it is conducting business. One alternative would be to become more involved in the country where the business is taking place. A positive image needs to be put forth. Talisman needs to show others that it wants to make a difference in the Kurdistan region. With the $220 million that is to be paid to the Kurdistan Regional Government (KRG), it is possible that Talisman could approach the KRG and make some kind of a deal regarding the use of the money. Hopefully this will ensure that it is used to build affordabl e housing, hospitals, schools, roads, and improve drinking water.This has all been destroyed or damaged by past conflict within the country. The advantage of this action results in proving to others that the money is being spent to  improve economic development in the region of Kurdistan and not to create independence from Iraq. A disadvantage of this would be the actual cost to carry out such an amount of work. Ultimately, it would improve their public image and presence in Kurdistan and hopefully prevent any controversy while being there. Another alternative would be to continually evaluate their position while in Kurdistan. This involves evaluating risk to prevent unexpected risks from occurring or exposure to them. By doing this, Talisman would always be on top of the situation at hand and it will allow them to become more proactive in their presence there. It will also help them to decide to stay or leave at any particular time. An advantage of this would be awareness of the local conditions and political/economic environment.They would re-evaluate the risks on a regular basis. This should prevent them from making the same mistakes as they did in Sudan. A disadvantage of this again would be that it is more costly. In addition, Talisman is risking the chances of another company taking the opportunity to enter the region and gain control of the oil reserves. The end result would be that Talisman would be receiving constant updates on the situation in Kurdistan.RecommendationTalisman Energy Inc. is a company that has had their fair share of problems when dealing with areas involving high political risk, such as Sudan. During their time there, they learned a great deal about risk and what to look for to reduce it to an acceptable level for investment purposes. The best way to reduce risk is too continually evaluate the region in which they are conducting business. With all the experience that Talisman has gained in Sudan they should now have a higher level of knowledge and comfort in doing business in Kurdistan. Talisman should now find it easier to discover political risks in new investment ventures. By completing the proper due diligence and exploration of political, legal, social and human rights issues, they should excel in doing business in the Kurdistan region.One must always remember when conducting business in an area with high political risks come high cost. If Talisman decides to enter Kurdistan it has to make sure that the $220 million dollar payment to the Kurdistan Regional Government is transparent and that it meets the standards of the Extractive Industries Transparency Initiative (Talisman Energy Inc.: The Decision to  Enter Iraq, 2009). A deal should try and be made with the KRG to ensure that the money be spent on economic development and not on weapons. This would show the people of the region and the world that Talisman wants to help the people of Kurdistan improve their country, while at the same time establish a viable relationship with the region in order to successfully operate its business in the oil industry. Talisman Energy Executive SummaryTalisman Energy Inc. (Talisman) is an independent Canadian oil and gas producer. Talisman is a company that has been through a great deal of criticism due to their negative experience in Sudan in previous years. They were accused of numerous things such as fueling the civil war, believing the Sudanese Government was using oil revenues to purchase weaponry, and of being complicit in human rights abuses because of fees and royalties paid to the government for the rights to explore oil and gas.Now, Talisman is faced with the decision of whether or not they should enter into Kurdistan, knowing that the same thing can happen there as it did in Sudan. The KRG is asking for $220 million in exchange for allowing Talisman to search for oil reserves. Not knowing what the KRG will use the money for, whether it’s to improve economic development or to purchase weaponry creates a dilemma for Talisman. The board of directors had first-hand experience of the damage to Talisma n’s reputation. With proper due diligence and continuous re-evaluation of the situation in Kurdistan, Talisman should now find it easier to discover political risk and solve problems before they arise.Problem StatementTalisman Energy Inc. has encountered problems in the past when entering into politically unstable markets in other countries. Now they are faced with the decision whether to enter the oil-rich Kurdistan region of Iraq, knowing there are great risks associated with it. If they decide to enter Kurdistan, can they do it without facing the same problems as they did in Sudan? AnalysisTalisman’s interest in pursuing oil exploration in the Kurdistan region of Iraq has been shaped by many factors. First being that Kurdistan is estimated to have 39 million barrels of oil reserves. Second, Talisman was optimistic about the opportunity for foreign oil companies to tap into Iraqi oil now that Saddam Hussein had been defeated. Finally, the Kurdistan area was viewed as significantly safer than the rest of Iraq.Talisman Energy Inc. is a company who has experience doing business in countries with high political risk. Political risk can be caused by conflict and violence, terrorism and kidnapping, property seizure, policy changes, and local  content requirements (Wild & Wild, International Business, 2012). Corruption sometimes plays a role in international business. See table 1 for the Corruption perception index. The higher the CPI score the less corruptive the country is.Table 1 Corruption Perception Index Country CPI ScoreFinland9.0 to 10.0 Canada8.0 to 8.9 United States of America7.0 to 7.9 Spain6.0 to 6.9 Hungary5.0 to 5.9 Greece4.0 to 4.9 Mexico3.0 to 3.9 Russia2.0 to 2.9 Iraq1.0 to 1.9Talisman is now faced with the decision of whether or not they should enter into Kurdistan given the uncertainty in such an unstable region. Have they done the proper due diligence to proceed into Iraq. Iraq is a region with high political risk see Exhibit 1 ( Wild & Wild, International Business, 2012). Exhibit 1 Political risk around the World)In retrospect, should Talisman have gone into Sudan?Talisman made a good decision by entering Sudan. They were aware of the risks but the rewards were potentially high. It was for this reason they took the chance. They were faced with many challenges such as being blamed for influencing the Civil War. Overcoming these challenges only made the company stronger and more knowledgeable for similar future situations. What are the learnings from the Sudan experience?Talisman learned a great deal from the Sudan experience. They established a dedicated Corporate Responsibility Group (CR) in response to the events in Sudan. The CR group have developed Talisman’s CR policies, procedures and  reporting protocols. Over the years, they have included government relations and responsibility for assessing the risks involved in new projects, especially when entering countries that have high political risk. The company has also added the International Code of Ethics for Canadian Business to its existing corporate code of ethics (Talisman Energy Inc.: The Decision to Enter Iraq, 2009).For more information on how Talisman manages their corporate responsibility see Exhibit 2. Exhibit 2 Talisman managing Corporate Responsibility Their commitment to corporate responsibility is founded in their company values. Their people put these values into action daily. Their dedication to making Talisman a great corporate citizen is built into the policies, systems, procedures and practices they have put in place to keep them improving. Their values include: Safety: Their goal is to create working conditions that cause no harm to people.Passion: They inspire others by the passion they demonstrate in their work. Results: They have a bias for results and take initiative to get things done efficiently, creating value for their shareholders. Respect: They take time to consider and appreciate other peopleà ¢â‚¬â„¢s points of view and treat the environment with respect. Excellence: They strive for excellence in what they do and how they do it. Teamwork: by working effectively together, they can deliver results far beyond their individual capabilities. Honest communication: They show courage to speak honestly and support others to do the same. How much money can Talisman make by entering Iraq?If the U.S geological survey is correct in estimating Kurdistan to have 39 billion barrels of oil reserves, then Talisman can make an enormous amount of money by entering Kurdistan. The world demand for oil in 2008 is forecast at 87 million barrels per day and the price of oil was US$130 per barrel (Talisman Energy Inc.: The Decision to Enter Iraq, 2009). The profit would be in the trillions. These large figures could cloud ones judgement when making such an important decision as this. The resources are there to generate huge profits but the circumstances they have to go through to do so  will ha ve to be examined. What are the costs and benefits for Talisman to enter Iraq?CostsA 220 million dollar payment has to be paid to the Kurdistan Regional Government. Talisman’s entry might be viewed as support for the Kurdistan government as it was in Sudan and as a result there could be opposition form the U.S government, which supports the unity of Iraq and the Iraqi central government. There has yet to be an agreement on revenue sharing (Talisman Energy Inc.: The Decision to Enter Iraq, 2009). This could cause problems between the central government and the Kurdistan Regional government. A decision to enter Iraq could ruin the reputation of the company if the same thing were to happen there as in Sudan. The Iraqi central government controls Iraq’s export pipeline system. Without the ability to export the oil, Talismans oil revenue would be significantly curtailed.Benefits†¢Have access to large amounts of oil reserves. †¢Financial growth resulting in trillio ns of dollars in profit. †¢An opportunity to invest in the region of Kurdistan. †¢An opportunity to increase the company’s overall market share. †¢An increased level of profit as a result of cheaper labour than other business ventures. Discussion of AlternativesThere are some alternatives that may help solve Talisman’s problems. Presented here are some advantages and disadvantages of each as well as how each would affect the company as a whole and the country in which it is conducting business. One alternative would be to become more involved in the country where the business is taking place. A positive image needs to be put forth. Talisman needs to show others that it wants to make a difference in the Kurdistan region. With the $220 million that is to be paid to the Kurdistan Regional Government (KRG), it is possible that Talisman could approach the KRG and make some kind of a deal regarding the use of the money.Hopefully this will ensure that it is use d to build affordable housing, hospitals, schools, roads, and improve drinking water. This has all been destroyed or damaged by past conflict within the country. The advantage of this action results in proving to others that the money is being spent to  improve economic development in the region of Kurdistan and not to create independence from Iraq. A disadvantage of this would be the actual cost to carry out such an amount of work. Ultimately, it would improve their public image and presence in Kurdistan and hopefully prevent any controversy while being there. Another alternative would be to continually evaluate their position while in Kurdistan.This involves evaluating risk to prevent unexpected risks from occurring or exposure to them. By doing this, Talisman would always be on top of the situation at hand and it will allow them to become more proactive in their presence there. It will also help them to decide to stay or leave at any particular time. An advantage of this would be awareness of the local conditions and political/economic environment. They would re-evaluate the risks on a regular basis.This should prevent them from making the same mistakes as they did in Sudan. A disadvantage of this again would be that it is more costly. In addition, Talisman is risking the chances of another company taking the opportunity to enter the region and gain control of the oil reserves. The end result would be that Talisman would be receiving constant updates on the situation in Kurdistan.RecommendationTalisman Energy Inc. is a company that has had their fair share of problems when dealing with areas involving high political risk, such as Sudan. During their time there, they learned a great deal about risk and what to look for to reduce it to an acceptable level for investment purposes. The best way to reduce risk is too continually evaluate the region in which they are conducting business. With all the experience that Talisman has gained in Sudan they should now have a higher level of knowledge and comfort in doing business in Kurdistan.Talisman should now find it easier to discover political risks in new investment ventures. By completing the proper due diligence and exploration of political, legal, social and human rights issues, they should excel in doing business in the Kurdistan region. One must always remember when conducting business in an area with high political risks come high cost. If Talisman decides to enter Kurdistan it has to make sure that the $220 million dollar payment to the Kurdistan Regional Government is transparent and that it meets the standards of the Extractive Industries Transparency Initiative (Talisman Energy Inc.: The Decision to

Friday, November 8, 2019

Development of IT skills Essay Example

Development of IT skills Essay Example Development of IT skills Essay Development of IT skills Essay You are required to compose on one topic of your pick. The 1000 word-limit does non include figures/tables or mentions. These essays subjects will non needfully include stuff from talks. They are intended to supply you with an chance to research new subjects that are complimentary to the faculty. Essaies must be word processed. This will help your development of IT skills. Transcripts of the essays must be saved electronically and you must upload your essay electronically to the Assignment Upload country in the VLE COMPULSORY DATA HANDLING PROBLEMS Along with the talk class and practical exercisings for this faculty, you are besides provided with four informations managing exercisings. These exercisings are designed to assist you derive insight into assorted facets of the class. If you have difficulty with any of these jobs, you should confer with Prof. Chopra every bit shortly as possible. PLEASE MAKE SURE THAT YOU COMPLETE EACH PROBLEM AS A SEPARATE PIECE OF WORK, EACH PAGE MUST BE ACCOMPANIED BY AN ASSESSED COURSEWORK COVERSHEET TO ENABLE EASE OF DISTRIBUTION TO MARKERS. PROBLEM 1: Case Study 1 ( Professor Mark Wilcox ) A four-year-old male child is referred to the clinic with a history of a painful arm and cubitus. He fell while on a mounting frame five yearss ago, and lacerated his right forearm. He has become more ailing in the last 24 hours with a febrility, purging, and abdominal hurting. On scrutiny he is suffering, dehydrated, and hectic. His right forearm is finely stamp over the country of the lesion and his cubitus is hot, conceited and stamp. His venters is stamp, but there is no recoil or guarding. His thorax is clear. The consequences of initial probes are given below. Questions 1. What is the likely diagnosing? Cellulitis. The male child fell and in making so lacerated the tegument on his forearm leting bacteriums, in this instance Staphylococcus aureus, to come in the tegument at the hypodermic or cuticular bed. The heat, hurting and redness at the country of the lesion are characteristic of cellulitis. The febrility and general unease that the male child is enduring from is besides declarative of cellulitis. Diagnosis would normally be carried out based on visual aspect and symptoms. 2. What farther probes would you execute? Blood trials or blood civilizations. Often it is hard to place the causative being through local civilizations. Blood civilizations are normally merely positive if the patient develops generalized sepsis. Cellulitis frequently has the same symptoms as a blood coagulum so it is sometimes utile to extinguish Deep Vein Thrombosis as a possible cause. Diagnosis of DVT can be done with a compaction leg ultrasound. 3. How would you handle this status? Initially I would rest the forearm and clean the lesion. I would propose giving antibiotics intra venously in the first 24-72 hours instead than orally, as the infection is distributing really fast and the patient has a high febrility. Intra venous antibiotics used could be penicillin-based antibiotics ( e.g. penicillin G or flucloxacillin ) or Mefoxins ( e.g. Claforan or cephazolin ) . Once symptoms have become less terrible and the patient is get downing to experience better I would order unwritten antibiotics such as penicillin, flucloxacillin, Ceftin, or Erythrocin and would propose the patient went place and rested. I would besides take a firm stand the patient completed his class of antibiotics until all marks of infection have disappeared, e.g. swelling or inflammation. PROBLEM 2: Case Study 2 ( Dr Richard Hobson ) A 43-year old male sheep-farmer nowadayss to his general practician kicking that he is traveling xanthous . He foremost noticed this one hebdomad antecedently. He has no other symptoms. Until last twelvemonth this adult male lived and worked in rural Greece, but he retired to the United Kingdom to be near to his household. Other than coming to the UK he has neer travelled outside mainland Europe. Physical scrutiny reveals mild icterus and a reasonably enlarged liver, which is otherwise wholly normal. An abdominal ultrasound scrutiny reveals the presence of a 9 centimeter fluid-filled pit within the right lobe of his liver and dilated intrahepatic gall canals, and is otherwise normal. Computed Tomography ( CT ) scanning confirms the presence of a 9 centimeter liver cyst and dilated gall canals, but once more is otherwise normal. Questions: 1. What two parasitic ( i.e. anthelmintic or protozoon ) diseases are most normally associated with big fluid-filled multitudes in the liver? Anthelmintic diseases are most normally associated with big fluids would be Entomoeba histolytica or Echinococcus granulosus. 2. Based on epidemiological and clinical findings, which is the most likely parasitic diagnosing in this instance, and why? Tapeworm. Echinococcus granulosus is common among sheep husbandmans as it cycles between carnivores ( Canis familiariss ) and herbivores ( sheep ) . The hydatid cysts typically develop in the liver and lungs, which explains his impaired liver map ( traveling yellow which would bespeak icterus ) and the cysts. 3. Describe in item how this disease is acquired. The sheep famer will hold acquired Echinococcus granulosus through inadvertent consumption of fecal matters of an septic Canis familiaris. Oncospheres would so be released into the duodenum of the husbandman, infiltrate the bowel and so be carried via the blood stream to different variety meats, in this instance the liver. 4. Give a full history of the diagnostic methods that are available to corroborate this diagnosing, and suggest specific trial ( s ) that should be undertaken in this patient. Medical imaging utilizing MRI or ultrasound can assist to place the presence of cysts. Serologic proving such as an Elisa trial can besides be carried out utilizing 96 good home bases coated with antigens from Echinococcus granulosus ( from hydatid fluid ) to IgG antibodies. ELISA trials can besides be performed to set up the presence of cyst fluid, protoscolex, and/or oncosphere antibodies in the serum. In the instance of positive consequences, the usage of ELISA and a hunt for anti-8 kD set antibodies by Western smudge can be carried out for a species-specific diagnosing. The presence of stray hooklets is diagnostic for echinococcosis. Hooklets can be observed in the hydatid fluid and can be visualised in the phlegm following purging. [ 1 ] Lesions can be detected by CT scan or sonography ; a septate construction is typical of active cysts. In the instance of this patient, cysts, dilated gall canals and lesions have been identified so I would urge an ELISA trial to corroborate an infection with Echinococcus granulosus tapeworms.1. [ 2 ] 5. Describe the life rhythm of the infecting being every bit to the full as possible, utilizing appropriate nomenclature. Compare and contrast this life rhythm with that of Taenia saginata, the beef cestode. The grownup cestode inhabits the little bowel of the marauder known as the unequivocal host ( in this instance the Canis familiaris ) . E. granulosus worms are typically 2 to 7 millimeters long and consist of a scolex with chumps and maulerss, every bit good as at least three sections ( known as proglottids ) . Proglottids have both male and female sexual variety meats and can bring forth parasite eggs that are up to 30-40 Â µm in size and contain embryos, known as oncospheres. [ 3 ] The eggs are excreted in the fecal matters of the unequivocal host and are released into the environment. They are morbific to susceptible intermediate hosts and can besides by chance infect worlds. The unequivocal host may be infected with 1000s of worms, each of which can bring forth 1000s of eggs per twenty-four hours. After consumption of the eggs by the intermediate host, the oncospheres hatch from the eggs, penetrate the enteric mucous membrane, so enter the blood and/or lymphatic system and migrate to the variety meats, peculiarly to the liver. A few yearss after the oncospheres reach the liver, a fluid-filled cyst begins to develop, which later differentiates into multiple beds to go the metacestode, known as a hydatid cyst. A cestode may go through through several intermediate hosts before it finds the right unequivocal host. In comparing sections incorporating eggs break off from the Taenia saginata worm and are so carried in the fecal bolus. The sections so deviate from the bolus and stick to the grass. However, in a similar mode to the E. granulosus worms the sections are ingested by a bovine intermediate host. Upon consumption the sections are digested in the intestine, breathing some 50,000 to 100,000 eggs. The eggs so emerge, each let go ofing a larva with 6 maulerss, known as the oncosphere or hexacanth. The oncosphore is able to infiltrate the intestine mucoa, making the musculuss via the blood stream ( oncospheres of E. granulosus besides penetrate the intestine wall and are besides carried by the blood stream ) . The oncosphere becomes filled with fluid and matures into a cysticercus ; 8mm in length. If an single chows raw or undercooked beef infected with the Taenia saginata worm, the cysticercus is explosions let go ofing the scolex. The scolex so attaches to the little bowel mucous membrane a nd begins to shoot off, organizing a long concatenation of sections. After 3 months the worm grows to 4-5 m in length and sections incorporating eggs interrupt off and get down to go through through the anus. The worm is long lasting, populating from 5 to 20 old ages or more. Worlds are the unequivocal host for the Taenia saginata worm, unlike E. granulosus worms where the Canis familiaris is the unequivocal host. [ 4 ] 6. Give a full history of the intervention options that are available for this disease, and the possible complications of the disease and/or its intervention? Open surgery used to be the individual method available for the intervention of Echinococcal cysts. New interventions going available though as experience grows. For illustration laparoscopic techniques such as the PAIR process, Percutaneous Aspiration, Introduction of a protoscolicidal agent and Reaspiration. Chemotherapy is besides another option of intervention which may forestall unneeded surgery. Some cysts have no symptoms, particularly if greatly calcified and hence thought to be nonviable so may merely necessitate simple observation. Northern or cervid strains cysts are likely to be straightforward and slow to develop. Nevertheless, the bulk of cysts, particularly if diagnostic or perchance feasible, should nt be left untreated. Treatment can include albendazole or mebendzole at a low dose over a long period of clip to take any larvae remaining in the organic structure, in combination with either surgery or the PAIR process. [ 5 ] [ 6 ] Possible complications include hazard of spliting a hydatid cyst during surgery doing spillage of protoscolices which may take to anaphylactic daze. Chemotherapy is chiefly parasitostatic and may therefore non be considered healing. PROBLEM 3: Antimicrobial Drug Action ( Professor Ian Chopra ) The undermentioned experiment was performed to analyze the consequence of antibiotics on the growing and viability of Staphylococcus aureus. Samples ( 10 milliliter ) from a civilization of S. aureus turning exponentially in Mueller-Hinton stock were pipetted into flasks incorporating synercid, or synercid and Achromycin, at the minimal concentration required to suppress growing and incubation was continued at 37 A ; deg ; C. A farther sample served as an antibiotic-free control. Aliquots were taken at intervals for finding of civilization denseness by an optical method and for finding of feasible cell Numberss by thining the civilization with unfertile saline and plating extra 0.2 milliliter samples onto the surface of Mueller-Hinton agar. After 24 h incubation at 37 A ; deg ; C the figure of settlements on each home base was counted and the consequences obtained are recorded in the Table below. During the 50 min incubation the optical denseness of the antibiotic-free control suspension of bacteriums increased by 75 % while the optical densenesss of the other civilizations remained changeless. Synercid is a mixture of two constituents, quinupristin and dalfopristin in the ratio of 30:70 ( w/w ) . The minimal growing repressive concentrations of quinupristin and dalfopristin are 30 and 20 Â µg/ml severally. When quinupristin, dalfopristin, and Achromycin were added separately to civilizations of S. aureus at their minimal growing repressive concentrations, there was no alteration in feasible cell Numberss during 50 min incubation. Questions 1. What decisions can be drawn from these informations on the effects of the antibiotics on S. aureus? Both antibiotics are effectual in cut downing settlement count of S. aureus. However combination therapy i.e. synercid and tetracycline together are more effectual than synercid on its ain. This is because synercid is a drug made up of two streptogramin antibiotics, quinupristin and dalfopristin which work synergistically to handle Staphylococcus infections. Streptogramins contain two structurally unrelated molecules, groups A and B. Quinupristin ( group A ) and dalfopristin ( group B ) bind to the 50S ribosomal fractional monetary unit but at different sites ; quinupristin at a site nearby to the 50S fractional monetary unit and dalfopristin to the 23S subdivision of the 50S fractional monetary unit. The binding of dalfopristin to the 23S subdivision brings about a conformational alteration therefore increasing the binding of quinupristin by up to 100 times. Quinupristin inactivates peptidyltransferase and dalfopristin precludes the placement of peptidyl-tRNA at the P site therefore suppressing peptide bond formation. Quinupristin and dalfopristin are effectual combinable antibiotics because they behave synergistically ; the binding of one promotes the binding of the other and individually their effects are bacteriostatic but in combination they have bactericidal belongingss. Tetracycline and synercid besides work synergistically because Achromycin prevents association of aminoacyl-tRNA with the ribosome by adhering to the 30S ribosomal fractional monetary unit and through an interaction with 16S rRNA prevents the moorage of amino-acylated transfer RNA. It hence follows that quinupristin, Achromycin and dalfopristin work by suppressing the same facet of ribosomal synthesis ; conveying about a ternary obstruction and in making so is more effectual in cut downing settlement count of Staphylococcus aureus. 2. What is the average coevals clip in proceedingss of the beings turning in the antibiotic-free control civilization? Average coevals clip is the clip taken for the figure of settlements of bacteriums in the sample to duplicate. By plotting a graph of clip against log to the base 10 of settlement organizing units and plotting a line of best tantrum, the gradient can be deduced. This value can so be put into this equation N= N0E kt where N equals the figure of settlements, N0 the initial population count, K is the changeless and T is clip ; the duplicating clip can be calculated. Bioinformatic analysis of a part of the chromosome of Staphylococcus aureus strain Mu50 that is indispensable for bacterial viability. The bulk of normally used antibacterial drugs mark comparatively few proteins or procedures within the bacterial cell. The handiness of bacterial genome sequences can be an of import factor in the hunt for fresh antibacterial agents aiming antecedently unexploited cellular procedures or tracts. S. aureus is an of import human pathogen and the genome sequences of a figure of strains have now been completed, including several methicillin immune strains. These microbic genomes, and many others, are held and can be analysed in silico at the Comprehensive Microbial Resource ( CMR ) on The J. Craig Venter Institute web site ( hypertext transfer protocol: //www.jcvi.org/cms/research/projects/cmr/ ) . Functional analysis of bacterial genomes involves the systematic scrutiny of the cellular map of all proteins encoded by the genome of a given bacterial species. Normally, jumping gene and insertional mutagenesis attacks are employed to look into cistron map. S. aureus Mu50 is a Vancocin immune strain of MRSA whose genome is 2.8 Mbp s in size. Functional analysis of the genome of this being has revealed a figure of parts of the chromosome that encode proteins which seem to be of import for cell viability. Such proteins, if non antecedently recognised as being required for viability, may stand for fresh marks for the development of antibacterial drugs. The DNA sequence of one such country of the S. aureus chromosome, the alleged yycFG part, can be downloaded from the MICR3290 are in the Blackboard VLE and should be used for this analysis. Previous familial experiments have shown that jumping gene mutations or insertionally inactivated mutations of the yycFG part can non be obtained. Important information required to finish this exercising. Deoxyribonucleic acid synthesis and written text occur in the 5 to 3 way and by convention DNA sequences are normally written in the 5 to 3 orientation. Bacterial chromosomes are dual isolated Deoxyribonucleic acid molecules. For convenience, DNA sequences are normally represented merely as the top ( + ) strand, even though the Deoxyribonucleic acid molecule is made up of two complementary anti-parallel strands. The top ( + ) strand is transcribed in the same way as the reproduction of the chromosome. You should observe nevertheless, that cistrons can besides be transcribed on the underside ( ) strand of the two-base hit stranded DNA molecule. S. aureus about ever uses ATG as a start codon and can utilize both TAA and TAG as stop codons. The ATG start codon codifications for methionine, which is the first amino acid of a translated protein sequence. Ribosome binding sites ( RBSs ) of cistrons are normally located instantly upstream of start codons. In staphyloccal cistrons RBSs are hard to foretell but recognized sequences include GTAAT, AAAGA and TAGAG. When shoping DNA and protein sequences to place possible start codons and ORF s it is frequently utile to utilize a position that displays both the base and matching protein sequence together. For the intent of this exercising merely DNA sequences coding for proteins larger than 150 aminic acids should be considered likely ORFs. A utile tool for interpreting DNA sequences in all reading frames can be found on the Expert Protein Analysis System ( ExPASy ) web site ( hypertext transfer protocol: //ca.expasy.org/tools/dna.html ) . Simply paste the protein sequence into the question box. Unknown protein sequences can be compared with proteins held in sequence databases utilizing the Basic Local Alignment Search Tool ( BLAST ) . BLAST analyses can be carried out utilizing the National Centre for Biotechnology Information ( NCBI ) web site ( hypertext transfer protocol: //www.ncbi.nlm.nih.gov/BLAST/ ) . Simply choice protein blast and paste in the protein sequence in the enter question sequence box. Published literature on peculiar scientific subjects or associating to specific cistrons or proteins can be searched utilizing the Pubmed tool on the NCBI web site ( hypertext transfer protocol: //www.ncbi.nlm.nih.gov/entrez/query.fcgi? db=PubMed ) . Simply enter a cistron name, keywords, or writer names into the hunt box. The molecular weights and pi s of proteins can be calculated utilizing the pI/Mw tool on the ExPASy web site ( hypertext transfer protocol: //ca.expasy.org/tools/pi_tool.html ) . Simply paste the protein sequence into the question box. One protein may be composed of several different spheres. The sphere administration of proteins can be predicted utilizing the Pfam tool on the Sanger Institute web site ( hypertext transfer protocol: //pfam.sanger.ac.uk/ ) . Simply paste the protein sequence into the box in the SEQUENCE SEARCH drop-down list. Bacterial proteins can be localised in the cytoplasmatic membrane by membrane crossing trans-membrane sections. The presence of trans-membrane sections and therefore the likely cytoplasmatic membrane topology of proteins can be predicted utilizing the Dense Alignment Surface ( DAS ) method on the Stockholm Bioinformatics Centre web site ( hypertext transfer protocol: //www.sbc.su.se/~miklos/DAS/ ) . Simply paste the protein sequence into the question box. In silico analysis In this exercising you will utilize a figure of web-based tools to putatively place, analyse and look into the nature of any proteins encoded in the yycFG part of the S. aureus genome. However, you should be cognizant that these tools are prognostic but non unequivocal and hence, merely supply a anticipation of the likely individuality and belongingss of proteins. All the bioinformatics tools and information required to finish this exercising are indicated above usage it. You should utilize the DNA sequence of the yycFG part ( provided below ) with the tools and information detailed above to make the undertakings indicated below. ( 1 ) Potential ORFs in the yycFG part. Translate the Deoxyribonucleic acid to place any likely unfastened reading frames ( ORFs ) in the yycFG part of the S. aureus Mu50 chromosome, ie DNA sequences that could potentially code for proteins. ( A ) How many possible ORFs are present in the Deoxyribonucleic acid sequence? Show the corresponding protein sequences for all possible ORFs that you find. There are three possible ORFs nowadays in the Deoxyribonucleic acid sequence. The corresponding sequences are listed below: RVEALDISSNNMSRGRKRMKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNINQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKKTIFTEFDPDKMTQVFDNVITNAMKYSRGKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEVIEDGDWDE EKRFMQMARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE IINIILSFFVLYRLCLCKKSQDVAYYFCNSLTMKSLKTVIGMNNKEHIKSVILALLVLMSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTTPMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIPDLSSDFTLFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRHDYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVFNTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKMEETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGEKGVFDYRRSLLRTDVVLNSEDNKTLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSDHNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE ( B ) Remark on the reading frame ( s ) and the likely way of written text of the cistron ( s ) that you identify. There are six reading frames because DNA is anti-parallel, dual stranded and can be read in both waies. It is besides made up of a three codification giving rise to three different reading frames. Therefore it follows that there are three different reading frames for two anti-parallel DNA strands giving six in entire. The likely way of written text is in both waies as two of the protein sequences are being read in the way of the 5 terminal and one is being read in the way of the 3 terminal. ( 2 ) In silico word picture of possible proteins encoded in the yycFG part. A good indicant of protein map can frequently be obtained by comparing protein sequences with other proteins for which the map is known. The sequences of such proteins are frequently found in sequence databases. ( A ) What are the possible maps of the proteins identified in the yycFG part? Three different proteins can be identified in the yycFG part. YycH is involved in signal acknowledgment. It is hypothesised that YycH maps as an adversary to YycG. YycH is transported across the cytoplasmatic protein. The molecule is made up of three spheres, and has a fresh 3-dimensional construction. The N-terminal sphere features a Ca binding site and the cardinal sphere contains two conserved loop parts. YycG proctors environmental signals and signifiers a two constituent system together with its response regulator YycF. YycF- response regulator. It receives signals from its associated histidine kinase YycG through a phosphor-transfer reaction and obtains responses through ordinance of cistron look. ( B ) Are the possible maps of any identified proteins likely to be linked to each other and if so, how? All of the proteins are likely to be linked to each other because YycG and YycF form a two constituent system together and YycH is an adversary to YycG. The proteins are responsible for signalling, feeling and reacting. ( C ) Why is it non possible to obtain jumping gene or insertional mutations in the yycFG part? The yycFG part is indispensable for viablity in Gram +ve bacterium. Therefore jumping gene or insertional mutations are non possible because strike harding out the yycFG part will kill the bacteriums. ( 3 ) Predicted sphere administration. A figure of web-based bioinformatics tools exist that allow anticipations to be made about the likely belongingss of proteins encoded in genome sequences. ( A ) How many aminic acids long are the proteins identified above and what are their predicted molecular weights and isoelectric points? For the first sequence the protein identified is 208 aminic acids long and the isoelectric point is 5.97 and the predicted molecular weight is 71765.15. For the 2nd sequence the protein identified is aminic acids 79 long and the isoelectric point is 5.14 and the predicted molecular weight is 28011.95. For the 3rd sequence the protein identified is aminic acids 161 long and the isoelectric point is 5.90 and the predicted molecular weight is 55632.77. ( B ) A individual protein can frequently hold several different spheres each with a different map. Represent the predicted sphere administration of the identified proteins graphically and remark on the likely map of each putative sphere. ( C ) Are any of the identified proteins predicted to be localised in the cytoplasmatic membrane? If so, which one ( s ) and how does this peculiar sub-cellular location relate to the likely maps of the protein ( s ) ? yycH and yycG both have localised parts in the cytoplasmatic membrane. This is because the proteins are involved in modulating cell wall homeostasis, cell division and cell membrane unity. ( 4 ) Using the information obtained above, and any other appropriate beginnings, remark on the suitableness of the proteins encoded in the yycFG part of the S. aureus Mu50 chromosome as marks for the development of antibacterial agents. yycFG is a two-component signal transduction system ( TCS ) and is responsible for the ordinance of cell wall metamorphosis. It is indispensable for Gram +ve viability, so hence S. aureus would nt last if it was knocked out, supplying a possible mark for antibacterial agents. Winkler and Hoch in their paper Essentiality, Bypass, and Targeting of the YycFG ( VicRK ) Two-Component Regulatory System in Gram-Positive Bacteria suggest happening general inhibitors of histidine kinase autophosphorylation or phosphoryl group transportation between associated histidine kinases and response regulators as a possible mechanism for usage in antibacterial agents. Inhibition of the yycF histidine kinase could be another possible mark for antibacterial agents, nevertheless it has been suggested that suppressing a individual mark may increase the likeliness of opposition. If one antibiotic is good, two should be better The usage of a combination of antibiotics is considered to give a better clinical result. This is because a scope of antibiotic spectrum can be increased, chance of bacteriums mutating to go immune can be reduced, dose can be decreased and different manners of action can be exploited. Therefore it is widely considered to be more effectual to utilize combination therapy, i.e. ordering two or more different antibiotics for one infection. For illustration in the instance of HIV patients with an increased susceptibleness to the timeserving infection Pneymocystic carinii pneumonia, due to their immuno-compromised province, a combination of sulphonamides and trimethoprim antibiotics are prescribed. Co-trimoxazole contains trimethoprim and sulfamethoxazole, in a one to five ratio. The antibiotics in Co-trimoxazole work synergistically as they target the same tract. Sulfamethoxazole plants by suppressing the synthesis of dihydropteroate by moving as a competitory inhibitor to the dihydropteroate synthase enzyme by barricading the Para-amino benzoic acid adhering site. Trimethoprim is structurally similar to dihyrdrofolic acid enabling it to suppress the enzyme dihyrdofolate reductase forestalling the synthesis of tetrahydrofolic acid. This is highly damaging as bacteriums require folic acid to synthesize thymidine and uridine, the two nucleosides indispensable for written text and DNA reproduction. This interactive dual ob struction of the folic acid rhythm is really effectual and allows patients to return place and take the antibiotics orally without necessitating long hospitalization. Below is a diagram of the tetrahydrofolate synthesis tract, bespeaking the points of suppression by Gantanol and trimethoprim. Combinable therapy can assist to get the better of immune bacteriums and better the efficaciousness of antibiotics. Clavulanic acid can be used in concurrence with penicillin antibiotics. The penicillin antibiotics oxacillin and methicillin and the of course happening penicillin G are normally susceptible to bacteriums able to bring forth beta-lactamase enzymes. However due to the structural similarity clavulanic acid is able to move as a competitory inhibitor to penicillinases and suppress them, therefore reconstructing the penicillin antibiotics activity over beta-lactamase releasing bacteriums. Bacterias can derive opposition to antibiotics in a figure of ways. First, the antibiotic can be chemically altered or destroyed, e.g. through the activity of penicillinases or through alteration of aminoglycoside enzymes. Second, the antibiotic mark may be altered to forestall the activity of the drug, e.g. trimethoprim can be inactivated by alterations in the Dihyrdrofolate reductase enzyme, quinolone opposition is marked by debaring binding of the drug to the mark, in this instance DNA gyrase, this is brought approximately by point mutants. Finally, alternate tracts may be created to avoid the drug mark. This is seen in methicillin immune Staphylococcus aureus where an extra penicillin adhering protein ( PBP2 ) inhibits the binding of drug to the mark ; therefore PBP2 is non vulnerable to suppression by penicillins. Rifamycin antibiotics are frequently used in combination with other antibiotics. Rifamycins block the production of courier RNA, and hence protein synthesis, by adhering to the beta-subunit of RNA polymerase, the nucleus enzyme. This action displaces the Mg incorporating active site on the beta-subunit, the secondary consequence being that RNA can no longer be held and is truncated through the secondary channel. Rifamycins are used in concurrence with INH, pyrazinamide or streptomycin in the intervention of TB and with Vancocin to handle penicillin-resistant Staphylococci pneumonia. Leprosy is treated with Multi Drug Therapy ( MDT ) to cut down the hazard of Mycobacterium leprae and Mycobacterium lepromatosis, the causative bacteriums of leprosy, mutating to go immune to the antibiotics, so rifampicin, dapsone and clofazimine are used together as MDT. Using two or more drugs to handle one infection is eff

Wednesday, November 6, 2019

Declaration of the Rights essays

Declaration of the Rights essays For this book review I decided to write about The Declaration of the Rights of Man and Citizen. I picked this section of the book, because over all I feel it is a very important subject. Which Im sure that Lynn Hunt did to, otherwise she would have not gave it a whole section. In this section it goes through the debates about The Declaration of Rights. How many of the people thought that the declaration to be necessary for a future constitution. On there other side of the argument many of the other people thought that the declaration would be dangerous by leading people to think there would be massive changes, which they were not looking forward to. There were many speeches given on both sides for and against the declaration. Marquis De Lafayette spoke about man has no other limits than to assure enjoyment to members of their society. Duke Mathieu De Montmorency gave a speech about his wish for the declaration to be clear, simple, and precise. He believed that people are moving forward and could handle and needed these guide lines as long as they were short and understandable. Malouet spoke on his belief that you could not give rules and regulations to some one that has never been had rules before. They had been going on what they thought to be right, and probably would not stand for somebody to tell them how to live their life. The Duke also spoke on how he did not think that you should be able to make people serve in the army or navy, when it was once a choice to made by each individual. However he did agree that the declaration should be be an introduction to the constitution. He urged everyone to accelerate drafting by taking instruction from the work of the committee on the constitution and by postponing for later consideration. Every body agreed that they needed a declaration but the fight came in on what it was going to consist of. They seemed to only agree on not agreeing. Almost every thing got sent t...